General Information

  • ID:  hor004413
  • Uniprot ID:  P55099
  • Protein name:  Neurokinin-B
  • Gene name:  Tac3
  • Organism:  Mus musculus (Mouse)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031836 neuromedin K receptor binding; GO:0031837 substance K receptor binding
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0045777 positive regulation of blood pressure; GO:1902093 positive regulation of flagellated sperm motility
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DMHDFFVGLM
  • Length:  10(82-91)
  • Propeptide:  MRSAMLFAAVLALSLAWTFGAVCEEPQGQGGRLSKDSDLYQLPPSLLRRLYDSRPVSLEGLLKVLSKASVGPKETSLPQKRDMHDFFVGLMGKRNSQPDTPTDVVEENTPSFGILK
  • Signal peptide:  MRSAMLFAAVLALSLAWTFG
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Tacr3, Tacr2
  • Target Unid:   P47937, P30549
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55099-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004413_AF2.pdbhor004413_ESM.pdb

Physical Information

Mass: 137214 Formula: C55H78N12O15S2
Absent amino acids: ACEIKNPQRSTWY Common amino acids: DFM
pI: 4.11 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 68 Boman Index: -154
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 68
Instability Index: 5025 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA